UNC13B Antibody
| Name | UNC13B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83244 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SQLSELDQYHEQDDDHRETDSIHSCHSSHSLSRDGQAGFGEQEKPLEVTGQAEKEAACEPKEMKEDATTHPP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | UNC13B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | UNC13B |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: UNC13B Antibody [NBP1-83244] - Staining of human kidney shows moderate cytoplasmic positivity in tubular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/23984_UNC13B-Antibody-Immunohistochemistry-NBP1-83244-img0003.jpg)
Immunohistochemistry: UNC13B Antibody [NBP1-83244] - Staining of human kidney shows moderate cytoplasmic positivity in tubular cells.