SCN11A Antibody
| Name | SCN11A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82600 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:EERNGNLEGEARKTKVQLALDRFRRAFCFVRHTLEHFCHKWCRKQNLPQQKEVAGGCAAQSKDIIPLVME |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SCN11A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SCN11A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SCN11A Antibody [NBP1-82600] - Staining of human rectum shows moderate cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/2521_SCN11A-Antibody-Immunohistochemistry-NBP1-82600-img0002.jpg)
Immunohistochemistry: SCN11A Antibody [NBP1-82600] - Staining of human rectum shows moderate cytoplasmic and membranous positivity in glandular cells.