CACNA2D4 Antibody
| Name | CACNA2D4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85920 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NDFINIIAYNDYVHYIEPCFKGILVQADRDNREHFKLLVEELMVKGVGVVDQALREAFQILKQFQEAKQGSLCNQAIM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CACNA2D4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CACNA2D4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunohistochemistry-Paraffin: CACNA2D4 Antibody [NBP1-85920] - Staining of human appendix shows strong positivity in a subset of glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25739_CACNA2D4-Antibody-Immunohistochemistry-Paraffin-NBP1-85920-img0005.jpg)
![Immunohistochemistry: CACNA2D4 Antibody [NBP1-85920] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25740_CACNA2D4-Antibody-Immunohistochemistry-NBP1-85920-img0004.jpg)