PDCD10 Antibody
| Name | PDCD10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86574 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PDCD10 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PDCD10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: PDCD10 Antibody [NBP1-86574] - Staining of human adrenal gland shows strong positivity in cortical cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/720_PDCD10-Antibody-Immunohistochemistry-NBP1-86574-img0003.jpg)
Immunohistochemistry: PDCD10 Antibody [NBP1-86574] - Staining of human adrenal gland shows strong positivity in cortical cells.