PI 3-Kinase C2 beta Antibody
| Name | PI 3-Kinase C2 beta Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86795 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ITSALNQLPPCPSRMQPKIQKDPSVLAVRENREKVVEALTAAILDLVELYCNTFNADFQTAVPGSRKHDLVQEACHFARSLAFTVYATHR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PI 3-Kinase C2 beta Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PIK3C2B |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: PI 3-Kinase C2 beta Antibody [NBP1-86795] - Staining of human appendix shows strong cytoplasmic and membrane positivity in glandular epithelium.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24389_PI-3-Kinase-C2-beta-Antibody-Immunohistochemistry-NBP1-86795-img0003.jpg)
Immunohistochemistry: PI 3-Kinase C2 beta Antibody [NBP1-86795] - Staining of human appendix shows strong cytoplasmic and membrane positivity in glandular epithelium.