MYCBP2 Antibody
| Name | MYCBP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84647 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GTWVQLDQNSMVEFCESDEGEAWSLARDRGGNQYLRHEDEQALLDQNSQTPPPSPFSVQAFNKGASCSAQGF |
| Description | Rabbit Polyclonal |
| Gene | MYCBP2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: MYCBP2 Antibody [NBP1-84647] - Staining of human testis shows distinct cytoplasmic positivity in cells of seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24549_MYCBP2-Antibody-Immunohistochemistry-NBP1-84647-img0003.jpg)
Immunohistochemistry: MYCBP2 Antibody [NBP1-84647] - Staining of human testis shows distinct cytoplasmic positivity in cells of seminiferus ducts.