ENPP4 Antibody
| Name | ENPP4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81466 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQW |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ENPP4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ENPP4 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ENPP4 Antibody [NBP1-81466] - Staining of human kidney shows cytoplasmic, membranous and nuclear positivity in renal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24562_ENPP4-Antibody-Immunohistochemistry-NBP1-81466-img0003.jpg)
Immunohistochemistry: ENPP4 Antibody [NBP1-81466] - Staining of human kidney shows cytoplasmic, membranous and nuclear positivity in renal tubules.