PTP pi/PTPRU Antibody
| Name | PTP pi/PTPRU Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81873 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:TFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGTRAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PTP pi/PTPRU Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PTPRU |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: PTP pi/PTPRU Antibody [NBP1-81873] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/762_PTP-pi-PTPRU-Antibody-Immunohistochemistry-NBP1-81873-img0003.jpg)
Immunohistochemistry: PTP pi/PTPRU Antibody [NBP1-81873] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.