STRA13 Antibody
| Name | STRA13 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84760 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MEGAEAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | STRA13 Protein |
| Description | Rabbit Polyclonal |
| Gene | BHLHE40 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: STRA13 Antibody [NBP1-84760] - Staining of human salivary gland shows strong cytoplasmic positivity in ductal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24744_STRA13-Antibody-Immunohistochemistry-NBP1-84760-img0003.jpg)
Immunohistochemistry: STRA13 Antibody [NBP1-84760] - Staining of human salivary gland shows strong cytoplasmic positivity in ductal cells.