Cyclin-O Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-14806
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids: GRRDNDQNLRAPVKKSRRPRLRRKQPLHPLNPCPLPGDSGICDLFESPSS GSDGAESPSAARGGSPLPGPAQPVAQLDLQ
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: Cyclin-O Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: CCNO
• Conjugate: Unconjugated

Product images

Immunohistochemistry-Paraffin: Cyclin-O Antibody [NBP2-14806] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Cyclin-O Antibody [NBP2-14806] - Staining of human stomach shows moderate cytoplasmic positivity in subset glandular cells.

Immunohistochemistry-Paraffin: Cyclin-O Antibody [NBP2-14806] - Staining of human pancreas shows moderate cytoplasmic positivity in subset exocrine glandular cells.

Immunohistochemistry-Paraffin: Cyclin-O Antibody [NBP2-14806] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.