ULBP-4/RAET1E Antibody
| Name | ULBP-4/RAET1E Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13198 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: QFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGD CDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLP |
| Purity/Format | Affinity purified |
| Blocking Peptide | ULBP-4/RAET1E Protein |
| Description | Rabbit Polyclonal |
| Gene | RAET1E |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: RAET1E Antibody [NBP2-13198] Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24855_RAET1E%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13198-img0001.jpg)
Immunohistochemistry-Paraffin: RAET1E Antibody [NBP2-13198] Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.