APXL Antibody
| Name | APXL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13308 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: PPLLIQDEDSTRIERVMDNNTTVKMVPIKIVHSESQPEKESRQSLACPAE PPALPHGLEKDQIKTLSTSEQFYS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | APXL Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SHROOM2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: APXL Antibody [NBP2-13308] - Immunofluorescent staining of human cell line MCF7 shows localization to cell junctions.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9336_APXL%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13308-img0003.jpg)
Immunocytochemistry/Immunofluorescence: APXL Antibody [NBP2-13308] - Immunofluorescent staining of human cell line MCF7 shows localization to cell junctions.
![Immunohistochemistry-Paraffin: APXL Antibody [NBP2-13308] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9337_APXL-Antibody-Immunohistochemistry-Paraffin-NBP2-13308-img0001.jpg)
Immunohistochemistry-Paraffin: APXL Antibody [NBP2-13308] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.