SPP2 Antibody
| Name | SPP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13373 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: FPVYDYDPSSLRDALSASVVKVNSQSLSPYLF |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SGPP2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: SPP2 Antibody [NBP2-13373] Staining of human duodenum shows strong cytoplasmic positivity in subset of glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24914_SPP2%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13373-img0001.jpg)
Immunohistochemistry-Paraffin: SPP2 Antibody [NBP2-13373] Staining of human duodenum shows strong cytoplasmic positivity in subset of glandular cells.