Neudesin Antibody

Name Neudesin Antibody
Supplier Novus Biologicals
Catalog NBP2-13652
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: LDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSP NLDFKPEDQP
Purity/Format Immunogen affinity purified
Blocking Peptide Neudesin Protein
Description Rabbit Polyclonal
Gene NENF
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.