N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody
| Name | N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13645 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: YYSTHLQRWLTYYPSGQLLIVDGQELRTNPAASMESIQKFLGITPFLNYT RTLRFDDDKGF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | N-Deacetylase/N-Sulfotransferase 2/NDST2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | NDST2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody [NBP2-13645] - Staining of human cell line PC-3 shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10892_N-Deacetylase-N-Sulfotransferase-2-NDST2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13645-img0003.jpg)
Immunocytochemistry/Immunofluorescence: N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody [NBP2-13645] - Staining of human cell line PC-3 shows positivity in cytoplasm.
![Immunohistochemistry-Paraffin: N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody [NBP2-13645] - Staining of human stomach (lower) shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10893_N-Deacetylase-N-Sulfotransferase-2-NDST2-Antibody-Immunohistochemistry-Paraffin-NBP2-13645-img0002.jpg)
Immunohistochemistry-Paraffin: N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody [NBP2-13645] - Staining of human stomach (lower) shows strong cytoplasmic positivity in glandular cells.