TSPAN12 Antibody
| Name | TSPAN12 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13489 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: DQMMSLKNDNSQHLSCPSVELLKPSLSRIFEHTSMANSFNTHFE |
| Description | Rabbit Polyclonal |
| Gene | TSPAN12 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: TSPAN12 Antibody [NBP2-13489] Staining of human testis shows moderate cytoplasmic and membranous positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/24988_TSPAN12%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13489-img0001.jpg)
Immunohistochemistry-Paraffin: TSPAN12 Antibody [NBP2-13489] Staining of human testis shows moderate cytoplasmic and membranous positivity in cells in seminiferus ducts.