CHSY1 Antibody
| Name | CHSY1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13838 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: HEELDAQELAKRINQESGSLSFLSNSLKKLVPFQLPGSKSEHKEPKDKKI NILIPLSGRFDMFVRFMGNFEKTC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CHSY1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CHSY1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: CHSY1 Antibody [NBP2-13838] Staining of human kidney shows strong membranous positivity in tubular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25112_CHSY1%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13838-img0001.jpg)
Immunohistochemistry-Paraffin: CHSY1 Antibody [NBP2-13838] Staining of human kidney shows strong membranous positivity in tubular cells.