DTX1 Antibody
| Name | DTX1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13940 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: RMDLAYPLTVGSIPKSQSWPVGASSGQPCSCQQCLLVNSTRAASNAILAS Q |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DTX1 Protein |
| Description | Rabbit Polyclonal |
| Gene | DTX1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-13940] Staining of human hippocampus shows strong cytoplasmic and nuclear positivity in glial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25117_DTX1%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13940-img0001.jpg)
Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-13940] Staining of human hippocampus shows strong cytoplasmic and nuclear positivity in glial cells.