DEGS2 Antibody

Name DEGS2 Antibody
Supplier Novus Biologicals
Catalog NBP2-13912
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: PEYYDHLPQHHSWVKVLWDFVFEDSLGPYARVKRVYRLA
Purity/Format Immunogen affinity purified
Blocking Peptide DEGS2 Protein
Description Rabbit Polyclonal
Gene DEGS2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.