Irisin/FNDC5 Antibody

Name Irisin/FNDC5 Antibody
Supplier Novus Biologicals
Catalog NBP2-14024
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGR NQQLR
Purity/Format Immunogen affinity purified
Blocking Peptide Irisin/FNDC5 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene FNDC5
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.