FFAR3/GPR41 Antibody
| Name | FFAR3/GPR41 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14014 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: DFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGC GTGGQVAC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FFAR3/GPR41 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FFAR3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: FFAR3/GPR41 Antibody [NBP2-14014] - Staining of human small intestine shows strong membranous and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19819_FFAR3-GPR41%2520Antibody-Immunohistochemistry-Paraffin-NBP2-14014-img0002.jpg)
Immunohistochemistry-Paraffin: FFAR3/GPR41 Antibody [NBP2-14014] - Staining of human small intestine shows strong membranous and cytoplasmic positivity in glandular cells.