ITGB1BP3 Antibody
| Name | ITGB1BP3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14135 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: KPQDQIAVGEDGFKQWDVLESLDMEAMLDTVQAWLSSPQKFARAHGVSVQ PEASDTHILLLEGFLLYSYKPLVDLY |
| Description | Rabbit Polyclonal |
| Gene | NMRK2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: ITGB1BP3 Antibody [NBP2-14135] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25218_ITGB1BP3-Antibody-Immunohistochemistry-Paraffin-NBP2-14135-img0002.jpg)
Immunohistochemistry-Paraffin: ITGB1BP3 Antibody [NBP2-14135] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.