HSD3B7 Antibody
| Name | HSD3B7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14103 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: VVRMLLQREPRLGELRVFDQHLGPWLEELKTGPVRVTAIQGDVTQAHEVA AAVAGAHVVIHTAGLVDVFGRASPKTIHEVNVQG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HSD3B7 Protein |
| Description | Rabbit Polyclonal |
| Gene | HSD3B7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: HSD3B7 Antibody [NBP2-14103] - Staining of human cell line Hep G2 shows localization to lipid droplets.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10070_HSD3B7-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14103-img0002.jpg)
![Immunohistochemistry-Paraffin: HSD3B7 Antibody [NBP2-14103] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10071_HSD3B7-Antibody-Immunohistochemistry-Paraffin-NBP2-14103-img0001.jpg)