LCLAT1 Antibody
| Name | LCLAT1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14187 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: ICLKASLKGVPGFGWAMQAAAYIFIHRKWKDDKSHFEDMIDYFCDIHEPL QLLIFPEGTDLTENSKSRSNAFAEKNGLQKYEYV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LCLAT1 Protein |
| Description | Rabbit Polyclonal |
| Gene | LCLAT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP2-14187] - Staining of human heart muscle shows cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/2458_LCLAT1%2520Antibody-Immunohistochemistry-Paraffin-NBP2-14187-img0003.jpg)
Immunohistochemistry-Paraffin: LCLAT1 Antibody [NBP2-14187] - Staining of human heart muscle shows cytoplasmic positivity in myocytes.