SIGLECL1 Antibody
| Name | SIGLECL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14393 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLLNSSCSLEKTLQCSCSFHGIPTPSVQWWMGGVPVGVDGMDGSLQVTST MLGPWANSTISLTEEPEMGMRLLCEGKNQNGTHA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SIGLECL1 Protein |
| Description | Rabbit Polyclonal |
| Gene | SIGLEC12 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: SIGLEC1 Antibody [NBP2-14393] - SIGLEC1 Antibody Staining of human pancreas shows strong cytoplasmic positivity(granular pattern) in exocrine glandular cells and islets of Langerhans.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25315_SIGLEC1-Antibody-Immunohistochemistry-Paraffin-NBP2-14393-img0002.jpg)
Immunohistochemistry-Paraffin: SIGLEC1 Antibody [NBP2-14393] - SIGLEC1 Antibody Staining of human pancreas shows strong cytoplasmic positivity(granular pattern) in exocrine glandular cells and islets of Langerhans.