C19orf21 Antibody
| Name | C19orf21 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14390 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: SQASGITGSYSVSESPFFSPIHLHSNVAWTVEDPVDSAPPGQRKKEQWYA GINPSDGINSEVLEAIRVTRHKNAMAERWESRIYASEEDD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C19orf21 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MISP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: C19orf21 Antibody [NBP2-14390] - Staining of human cell line U-2 OS shows positivity in plasma membrane & focal adhesion sites.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26796_C19orf21-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14390-img0003.jpg)
Immunocytochemistry/Immunofluorescence: C19orf21 Antibody [NBP2-14390] - Staining of human cell line U-2 OS shows positivity in plasma membrane & focal adhesion sites.
![Immunohistochemistry-Paraffin: C19orf21 Antibody [NBP2-14390] - Staining of human small intestine shows strong membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26797_C19orf21-Antibody-Immunohistochemistry-Paraffin-NBP2-14390-img0004.jpg)
Immunohistochemistry-Paraffin: C19orf21 Antibody [NBP2-14390] - Staining of human small intestine shows strong membranous positivity in glandular cells.
![Immunohistochemistry-Paraffin: C19orf21 Antibody [NBP2-14390] - Staining of human stomach, lower shows strong membranous and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26798_C19orf21-Antibody-Immunohistochemistry-Paraffin-NBP2-14390-img0002.jpg)
Immunohistochemistry-Paraffin: C19orf21 Antibody [NBP2-14390] - Staining of human stomach, lower shows strong membranous and cytoplasmic positivity in glandular cells.