C16orf73 Antibody
| Name | C16orf73 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14385 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: NMANLKVIGIVIGKTDVKGFPDRKNIGSERYTFSFTIRDSPAHFVNAASW GNEDYIKSLSDSFRVGDCVIIENPLIQRKEI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C16orf73 Protein |
| Description | Rabbit Polyclonal |
| Gene | MEIOB |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: C16orf73 Antibody [NBP2-14385] - Staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25349_C16orf73-Antibody-Immunohistochemistry-NBP2-14385-img0002.jpg)
Immunohistochemistry: C16orf73 Antibody [NBP2-14385] - Staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.