CACNA1E Antibody
| Name | CACNA1E Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14431 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: AHPSLYRRPRAIEGLALGLALEKFEEERISRGGSLKGDGGDRSSALDNQR TPLSLGQREPPWLARPCHGNCDPTQQ |
| Description | Rabbit Polyclonal |
| Gene | CACNA1E |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: CACNA1E Antibody [NBP2-14431] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25383_CACNA1E-Antibody-Immunohistochemistry-NBP2-14431-img0002.jpg)
Immunohistochemistry: CACNA1E Antibody [NBP2-14431] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.