CCL1/I-309/TCA-3 Antibody

Name CCL1/I-309/TCA-3 Antibody
Supplier Novus Biologicals
Catalog NBP2-14459
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: RAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPS
Purity/Format Immunogen affinity purified
Blocking Peptide CCL1/I-309/TCA-3 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene CCL1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.