Protocadherin-12 Antibody

Name Protocadherin-12 Antibody
Supplier Novus Biologicals
Catalog NBP2-13737
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: ENNLPSLHLITIKAHDADLGINGKVSYRIQDSPVAHLVAIDSNTGEVTAQ RSLNYEEMAGFEFQVIAEDSGQPMLASSVSVWVS
Purity/Format Immunogen affinity purified
Blocking Peptide Protocadherin-12 Protein
Description Rabbit Polyclonal
Gene PCDH12
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.