PILR-alpha Antibody
| Name | PILR-alpha Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13763 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: LRWRRRKGQQRTKATTPAREPFQNTEEPYENIRNEGQNTDPKLNPKDDGI VYASLA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PILR-alpha Protein |
| Description | Rabbit Polyclonal |
| Gene | PILRA |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: PILRA Antibody [NBP2-13763] Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25504_PILRA%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13763-img0001.jpg)
Immunohistochemistry-Paraffin: PILRA Antibody [NBP2-13763] Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.