PIGW Antibody
| Name | PIGW Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13762 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: FLIKGALVPCSWKLIQSPVTNKKHSESLVPEAERMEPSLCLITALNR |
| Description | Rabbit Polyclonal |
| Gene | PIGW |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: PIGW Antibody [NBP2-13762] - Staining of human kidney shows strong granular cytoplasmic positivity in subset of tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25505_PIGW-Antibody-Immunohistochemistry-NBP2-13762-img0002.jpg)
Immunohistochemistry: PIGW Antibody [NBP2-13762] - Staining of human kidney shows strong granular cytoplasmic positivity in subset of tubules.