PHF19 Antibody
| Name | PHF19 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13755 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: AIPSSDFTSAWSTNHHLASIFDFTLDEIQSLKSASSGQTFFSDVDSTDAA STSGSASTSLSYDSRW |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PHF19 Protein |
| Description | Rabbit Polyclonal |
| Gene | PHF19 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: PHF19 Antibody [NBP2-13755] - Staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/5341_PHF19-Antibody-Immunohistochemistry-Paraffin-NBP2-13755-img0002.jpg)
Immunohistochemistry-Paraffin: PHF19 Antibody [NBP2-13755] - Staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.