PRDM5 Antibody
| Name | PRDM5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13810 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: GDARFVCKADSCGKRLKSKDALKRHQENVHTGDPKKKLICSVCNKKCSSA SSLQEHRKIHEIFDCQECMKK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PRDM5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PRDM5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: PRDM5 Antibody [NBP2-13810] - Staining of human cell line RH-30 shows localization to nucleus, nucleoli & nuclear bodies.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5783_PRDM5-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13810-img0002.jpg)
![Immunohistochemistry-Paraffin: PRDM5 Antibody [NBP2-13810] - Staining of human colon shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5784_PRDM5-Antibody-Immunohistochemistry-Paraffin-NBP2-13810-img0001.jpg)