CNFN Antibody

Name CNFN Antibody
Supplier Novus Biologicals
Catalog NBP2-14668
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: MSYPVTSQPQCATTSCYQTQLSDWHTGLTDCCNDMPVCLCGTFAPLCLAC RISDDF
Purity/Format Immunogen affinity purified
Blocking Peptide CNFN Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene CNFN
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.