MACC1 Antibody
| Name | MACC1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89351 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DSSGDELDVHQLLRQTSSRNSGRSKSVSELLDILDDTAHAHQSIHNSDQILLHDLEWLKNDREAYKMAWLSQRQLARSCLDLNTISQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MACC1 Protein |
| Description | Rabbit Polyclonal |
| Gene | MACC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: MACC1 Antibody [NBP1-89351] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line A-431](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25031_MACC1-Antibody-Western-Blot-NBP1-89351-img0005.jpg)
![Immunohistochemistry-Paraffin: MACC1 Antibody [NBP1-89351] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25032_MACC1-Antibody-Immunohistochemistry-Paraffin-NBP1-89351-img0006.jpg)