C2GNT3 Antibody
| Name | C2GNT3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88270 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VKWNYYEGFFYPSCTGSHLRSVCIYGAAELRWLIKDGHWFANKFDSKVDPILIKCLAEKLEEQQRDWITLPS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C2GNT3 Protein |
| Description | Rabbit Polyclonal |
| Gene | GCNT4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: C2GNT3 Antibody [NBP1-88270] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4142_C2GNT3-Antibody-Immunohistochemistry-NBP1-88270-img0003.jpg)
Immunohistochemistry: C2GNT3 Antibody [NBP1-88270] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.