PCNXL4 Antibody
| Name | PCNXL4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87597 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NKSTTVERILTTDILAEEDEHEFTSCTGAETVKFLIPGKKYV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PCNXL4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KHSRP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PCNXL4 Antibody [NBP1-87597] - Staining of human cell line U-2 OS shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7813_PCNXL4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87597-img0004.jpg)
Immunocytochemistry/Immunofluorescence: PCNXL4 Antibody [NBP1-87597] - Staining of human cell line U-2 OS shows localization to cytosol.
![Immunohistochemistry: PCNXL4 Antibody [NBP1-87597] - Staining of human small intestine shows strong cytoplasmic positivity, with a granular pattern, in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7814_PCNXL4-Antibody-Immunohistochemistry-NBP1-87597-img0003.jpg)
Immunohistochemistry: PCNXL4 Antibody [NBP1-87597] - Staining of human small intestine shows strong cytoplasmic positivity, with a granular pattern, in glandular cells.