Spt6 Antibody
| Name | Spt6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34030 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RTTYIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVSDGIYQHVDVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Spt6 Protein |
| Description | Rabbit Polyclonal |
| Gene | SUPT6H |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Spt6 Antibody [NBP2-34030] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7535_Spt6-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34030-img0003.jpg)
Immunocytochemistry/Immunofluorescence: Spt6 Antibody [NBP2-34030] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.
![Immunohistochemistry: Spt6 Antibody [NBP2-34030] - Staining of human breast shows strong nuclear positivity in glandular cells and myoepithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7536_Spt6-Antibody-Immunohistochemistry-NBP2-34030-img0002.jpg)
Immunohistochemistry: Spt6 Antibody [NBP2-34030] - Staining of human breast shows strong nuclear positivity in glandular cells and myoepithelial cells.