CACNA1S Antibody
| Name | CACNA1S Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33799 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: EEEKSTMAKKLEQKPKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPLSPRPRPLAEL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CACNA1S Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CACNA1S |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33799] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4028_CACNA1S-Antibody-Immunohistochemistry-Paraffin-NBP2-33799-img0002.jpg)
Immunohistochemistry-Paraffin: CACNA1S Antibody [NBP2-33799] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.