NRAMP2/SLC11A2/DMT1 Antibody
| Name | NRAMP2/SLC11A2/DMT1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91841 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:TNEQVVEVCTNTSSPHAGLFPKDNSTLAVDIYKG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NRAMP2/SLC11A2/DMT1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC11A2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: NRAMP2/SLC11A2/DMT1 Antibody [NBP1-91841] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/26443_NRAMP2-SLC11A2-DMT1-Antibody-Immunohistochemistry-NBP1-91841-img0004.jpg)
Immunohistochemistry: NRAMP2/SLC11A2/DMT1 Antibody [NBP1-91841] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.