TIS11D Antibody
| Name | TIS11D Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92510 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAPGFLRRHSASNLHALAHPAPSPGSCSPKF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TIS11D Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZFP36L2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: TIS11D Antibody [NBP1-92510] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3249_TIS11D%2520Antibody-Immunohistochemistry-Paraffin-NBP1-92510-img0003.jpg)
Immunohistochemistry-Paraffin: TIS11D Antibody [NBP1-92510] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.