TM2D3 Antibody
| Name | TM2D3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30535 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: IPPYVMKCPSNGLCSRLPADCIDCTTNFSCTYGKPVTFDCAVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTNSTSCMTVSC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TM2D3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TM2D3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TM2D3 Antibody [NBP2-30535] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11858_TM2D3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30535-img0003.jpg)
Immunocytochemistry/Immunofluorescence: TM2D3 Antibody [NBP2-30535] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm & cytosol.
![Immunohistochemistry: TM2D3 Antibody [NBP2-30535] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11859_TM2D3-Antibody-Immunohistochemistry-NBP2-30535-img0001.jpg)
Immunohistochemistry: TM2D3 Antibody [NBP2-30535] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.