TM2D3 Recombinant Protein Antigen

Name TM2D3 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-30535PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody TM2D3 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene TM2D3
Sequence IPPYVMKCPSNGLCSRLPADCIDCTTNFSCTYGKPVTFDCAVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTNSTSCMTVSC
Description A recombinant protein antigen corresponding to TM2D3
Supplier Page Shop