USP46 Antibody (CL0364)
| Name | USP46 Antibody (CL0364) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30417 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a |
| Clone | CL0364 |
| Applications | WB ICC/IF |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQN |
| Purity/Format | Protein A purified |
| Description | Mouse Monoclonal |
| Gene | USP46 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: USP46 Antibody (CL0364) [NBP2-30417] - Lane 1: Marker [kDa]. Lane 2: Human cell line U-251 MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26937_USP46-Antibody-(CL0364)-Western-Blot-NBP2-30417-img0001.jpg)
Western Blot: USP46 Antibody (CL0364) [NBP2-30417] - Lane 1: Marker [kDa]. Lane 2: Human cell line U-251 MG
![Immunocytochemistry/Immunofluorescence: USP46 Antibody (CL0364) [NBP2-30417] - Staining of U-2 OS cells using the anti-USP46 monoclonal antibody, showing specific staining in nucleoli in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26938_USP46-Antibody-(CL0364)-Immunocytochemistry-Immunofluorescence-NBP2-30417-img0002.jpg)
Immunocytochemistry/Immunofluorescence: USP46 Antibody (CL0364) [NBP2-30417] - Staining of U-2 OS cells using the anti-USP46 monoclonal antibody, showing specific staining in nucleoli in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.