Mover Antibody
| Name | Mover Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30421 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TEHPMAGADEKTASLCQLESFKALLIQAVKKAQKESPLPGQANGVLILERPLLIETY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Mover Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TPRG1L |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Mover Antibody [NBP2-30421] - Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells while islets of Langerhans were negative.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/26836_Mover-Antibody-Immunohistochemistry-NBP2-30421-img0001.jpg)
Immunohistochemistry: Mover Antibody [NBP2-30421] - Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells while islets of Langerhans were negative.