| Name | Mover Recombinant Protein Antigen |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30421PEP |
| Category | Protein |
| Prices | $209.00 |
| Sizes | 100 µl |
| Applications | B/N |
| For Antibody | Mover Antibody |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E.coli |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Gene | TPRG1L |
| Sequence | TEHPMAGADEKTASLCQLESFKALLIQAVKKAQKESPLPGQANGVLILERPLLIETY |
| Description | A recombinant protein antigen corresponding to TPRG1L. Source: E.coli Amino Acid Sequence: TEHPMAGADEKTASLCQLESFKALLIQAVKKAQKESPLPGQANGVLILERPLLIETY |
| Supplier Page | Shop |