FLJ40125 Antibody
| Name | FLJ40125 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30946 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MTCILVCFPGAPRPSEEAIRRELALDAALGCRIAELCASAQKPPSLNTVFRTLASEDIPDLP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FLJ40125 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PPM1N |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: FLJ40125 Antibody [NBP2-30946] - Immunohistochemical staining of human pancreas shows strong nuclear membrane positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/27140_FLJ40125-Antibody-Immunohistochemistry-NBP2-30946-img0001.jpg)
Immunohistochemistry: FLJ40125 Antibody [NBP2-30946] - Immunohistochemical staining of human pancreas shows strong nuclear membrane positivity in exocrine glandular cells.