FLJ40125 Recombinant Protein Antigen

Name FLJ40125 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-30946PEP
Category Protein
Applications B/N
For Antibody FLJ40125 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PPM1N
Sequence MTCILVCFPGAPRPSEEAIRRELALDAALGCRIAELCASAQKPPSLNTVFRTLASEDIPDLP
Description A recombinant protein antigen corresponding to PPM1N. Source: E.coli Amino Acid Sequence: MTCILVCFPGAPRPSEEAIRRELALDAALGCRIAELCASAQKPPSLNTVFRTLASEDIPDLP
Supplier Page Shop