Name | APOBEC3F Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57372 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to APOBEC3F(apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F) The peptide sequence was selected from the middle region of APOBEC3F (NP_660341). Peptide sequence: MYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRL |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | APOBEC3F |
Conjugate | Unconjugated |
Supplier Page | Shop |