APOBEC3F Antibody

Name APOBEC3F Antibody
Supplier Novus Biologicals
Catalog NBP1-57372
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to APOBEC3F(apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F) The peptide sequence was selected from the middle region of APOBEC3F (NP_660341). Peptide sequence: MYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRL
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene APOBEC3F
Conjugate Unconjugated
Supplier Page Shop

Product images